PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 308aa    MW: 34951.9 Da    PI: 7.6064
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1244genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271.1e-082873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE + + +a +++ ++   +W ++a++++ g+t  +++  ++ 
      Gh_D04G1244 28 KWTPEENKCFENALALYDKDtpdRWIKVASMIP-GKTVGDVIKQYRE 73
                     8********************************.******9999986 PP

2Myb_DNA-binding47.25.1e-15135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
      Gh_D04G1244 135 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 179
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-42374IPR009057Homeodomain-like
PROSITE profilePS512939.572479IPR017884SANT domain
SMARTSM007179.6E-92577IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-112781IPR009057Homeodomain-like
CDDcd001678.30E-72874No hitNo description
PfamPF002491.5E-72873IPR001005SANT/Myb domain
PROSITE profilePS5129420.447128184IPR017930Myb domain
SuperFamilySSF466891.72E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-17131183IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.8E-13132179IPR009057Homeodomain-like
SMARTSM007172.1E-13132182IPR001005SANT/Myb domain
CDDcd001677.17E-11135180No hitNo description
PfamPF002492.0E-12135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNRGLEILSP ASYLHTSNWL FQESEGTKWT PEENKCFENA LALYDKDTPD RWIKVASMIP  60
GKTVGDVIKQ YRELEEDVSD IEAGLIPIPG YSRDSFTLEW GNDSQGFDGF RHYYTPGKRG  120
TGSRSSDQER KKGVPWTEEE HRQFLMGLKK YGKGDWRNIS RNFVTTRTPT QVASHAQKYF  180
IRQVTGGKDK RRSSIHDITT VNVPDTPSSS PDHCKHSSSS DSSAVIQAQQ QAKLATTKEI  240
DFEWKQQNGA AMVFNRTSNC NAFLPPFCGI SSYGPKLEEQ NLLGETLPRS QFGSYNTLFQ  300
MQSMQQHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-162691873RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.5910.0boll| ovule
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459704.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-112DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2V5590.0A0A0D2V559_G
STRINGPOPTR_0006s09860.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-128MYB family protein